Cresten Labs sells only through crestenlabs.eu and orders@crestenlabs.eu. Any other site or social account using our name is not us.
Skip to main content
Research Use Only, not for human or veterinary consumption Ships across the EU single market Verified, every batch
Order status
CompoundTesamorelin, stabilised GHRH analogue CategoryLongevity EditionCresten Labs Editorial, 2026
Research Use Only declaration

This compound is supplied for in-vitro and preclinical research only. It is not a medicinal product. It is not approved for human or veterinary use in any jurisdiction. No therapeutic, medicinal, cosmetic, or performance-enhancement claims are made or implied. By proceeding to inquire, you confirm you are an adult researcher acquiring this compound within your own research framework. Full terms on the Research Use Only page.

Longevity Research, Stabilised GHRH analogue

Tesamorelin

20 mg freeze-dried vial, stabilised GHRH analogue

Janoshik verified ISO/IEC 17025 COA pre-published Research use only
180+ PubMed-indexed publications cite Tesamorelin in preclinical and in-vitro literature. View bibliography on PubMed →
Every batch tested for HPLC purity by Janoshik before it ships. You receive the certificate for your batch with your order.
How verification works →
€129.99 In stock, ships within 24h
One acknowledgement step before submission. Inquiry sent to our research desk by email. Confirmation, payment, and dispatch handled directly. EU shipping only.
Certificate format Specimen
Bulk pricing: 5+ 5%, 10+ 10%, 25+ 15%, institutional accounts contact for tendered pricing
Research account standing. Cumulative orders across four rolling quarters trigger pricing tiers (Researcher 5%, Senior Researcher 7.5%, Principal Investigator 10%) applied automatically at checkout.
View standing program →
Custom quote, single or multi-compound Submit a request for quotation Custom quantities, vial-size variants, multi-compound orders, institutional accounts. Quote turnaround typically two to five business days.
Technical specifications · Tesamorelin Cresten Labs reference catalogue

Compound specifications, chemistry, and storage.

Technical specifications

Specimen format
Compound nameTesamorelin
Also known asTH9507, hexenoyl-GHRH, stabilised GHRH 1-44
CAS number901758-09-6
PubChem CID16129624
InChI KeyReference InChI Key on COA
SMILESReference SMILES on COA
Empirical formula (Hill notation)C221H366N72O67S
Molecular weight5135.85 g/mol (monoisotopic mass: 5132.71)
Salt formAcetate (default)
Counter-ion contentQuantified per batch on COA. Custom salt forms (chloride, ammonium, TFA) available on quote.
Sequence (1-letter)Hex-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Sequence (3-letter)N-Hexenoyl-modified GHRH 1-44 analogue
Length44 amino acids (modified GHRH 1-44) with N-terminal hexenoyl group
Weight basisGross weight per industry standard. Net peptide content quantified on batch COA.
Quantity per vial20 mg
FormatFreeze-dried white powder or thin film, sealed under inert atmosphere. Why does the vial look empty?
AppearanceWhite freeze-dried cake or powder. May also appear as a thin film on the vial wall.
SolubilityWater soluble, reconstituted with bacteriostatic water (1 to 2 ml typical)
Solution colourClear and colourless when correctly reconstituted
Purity (HPLC)Specification ≥98.5%, tested before listing
Identity confirmationLC-MS, batch-specific spectrum on COA
Endotoxin (LAL)Within Ph. Eur. specification, batch report on COA
Storage (freeze-dried)2 to 8 degrees Celsius, sealed, protected from light. Avoid thermal cycling.
Storage (reconstituted)2 to 8 degrees Celsius. Use within 4 to 6 weeks. Avoid repeated freeze-thaw.
Shelf life24 months from synthesis date when storage conditions are maintained
Country of synthesisEU partner facility, Ph. Eur. methodology references
ApplicationIn-vitro and preclinical research only. Not for human or veterinary use.
Research Use Only Supplied for in-vitro and preclinical laboratory research only. Not for human or veterinary use. Cresten Labs does not provide therapeutic or dosing guidance.
Compound monograph · Tesamorelin · longevity research Cresten Labs Editorial, 2026

A stabilised GHRH analogue, and what the published research says about it.

Tesamorelin is a synthetic 44-amino-acid analogue of native human growth-hormone-releasing hormone (GHRH 1-44) with a hexenoyl group attached to the N-terminus. The hexenoyl modification slows enzymatic degradation in plasma. Published research investigates the peptide for sustained activation of the GHRH receptor on anterior pituitary somatotrophs, with downstream measurements of growth-hormone secretion and IGF-1 levels in animal and clinical research. The sections below summarise what the published research investigates, what Cresten supplies, and what the certificate of analysis confirms.

Where Tesamorelin comes from.

Tesamorelin is a synthetic 44-amino-acid peptide identical in residue sequence to native human growth-hormone-releasing hormone (GHRH 1-44), with a hexenoyl group attached to the N-terminus. The compound was developed in the early 2000s by Theratechnologies under the research designation TH9507. The native GHRH 1-44 peptide undergoes rapid degradation in plasma by the enzyme dipeptidyl peptidase-4 (DPP-4); the hexenoyl modification at the N-terminus blocks the DPP-4 cleavage site and extends plasma half-life from minutes to roughly 30 to 40 minutes.

The peptide is produced by Fmoc solid-phase peptide synthesis followed by chemoselective hexenoyl attachment at the N-terminal pyroglutamate residue. After purification by reversed-phase HPLC the peptide is freeze-dried and sealed in vials. The published literature uses Tesamorelin and the development code TH9507 interchangeably, with the trade name applying to the approved pharmaceutical product.

PubMed lists roughly 180 papers mentioning Tesamorelin or TH9507 as of 2026. The research is concentrated in GHRH-receptor pharmacology, animal models of growth-hormone secretion, and clinical trials in HIV-associated lipodystrophy research, the indication for which the pharmaceutical product was approved. The compound has been studied in cognition-research contexts in older subjects in clinical settings. The research-supply form is identical in sequence to the approved pharmaceutical product but is supplied for laboratory research only.

What the research looks at.

Tesamorelin mechanism research starts from the GHRH receptor, the same class B G-protein-coupled receptor on which native GHRH and other GHRH analogues act. The peptide binds the receptor with affinity equivalent to native GHRH; the structural innovation of the hexenoyl modification affects plasma stability rather than receptor affinity. Cell-culture binding studies have confirmed that the hexenoyl group does not interfere with receptor occupancy or downstream signalling activation through the canonical Gs-cAMP-PKA pathway.

A second strand of research compares Tesamorelin against shorter GHRH fragments such as Sermorelin (GHRH 1-29) and CJC-1295 No DAC. The published literature describes the 44-residue full-length GHRH backbone as producing comparable receptor activation to the 29-residue fragments, with the additional 15 C-terminal residues contributing structural stability rather than additional receptor engagement. The mechanistic differences between the fragments are concentrated in plasma half-life rather than receptor pharmacology.

"The structural distinction of Tesamorelin in the published research is plasma stability through the N-terminal hexenoyl modification, not affinity or potency at the GHRH receptor itself."

A third line of research has examined the compound in clinical contexts. Published clinical trials measure growth-hormone-secretion patterns, IGF-1 cascade activation, and tissue-composition markers in defined patient populations. The clinical literature is more advanced than for most peptides in the research-supply category, given the approval of the pharmaceutical product for a specific indication. Cognition research in older subjects represents a separate published clinical-research strand.

Where the published research does not go in the research-supply context: laboratory research does not extend to administration to humans, off-label clinical use, or any therapeutic application. The approved pharmaceutical Tesamorelin is regulated separately. The research-supply form is supplied for laboratory research only.

Analytical characterisation

What the certificate confirms.

Every Cresten batch of BPC-157 ships with a certificate from an analytical lab, against the test panel described on the Methodology page. The certificate that ships with your batch confirms:

HPLC purity
main-peak percentage by area at 220 nm, gradient elution, dominant peak. Specification: minimum 98%.
LC-MS identity
Confirmed. Observed mass matches theoretical mass of 1419.55 g/mol within instrument tolerance.
Endotoxin (LAL)
Below detection limit. Specification: less than 5 EU/mg per Ph. Eur. 2.6.14.
Bioburden
Below detection limit per Ph. Eur. 2.6.12 microbial enumeration.
Report on file
Janoshik Analytical (batch certificate of analysis supplied with your order)

The certificate format is shown on the batch verification page.

Cited research

Selected published research on Tesamorelin.

Monograph last reviewed 26 May 2026 · references checked against PubMed

The curated reference list for Tesamorelin is being finalised against PubMed and will appear here. In the meantime, the indexed literature is available directly: PubMed results for Tesamorelin.

Citation note: each PMID resolves to PubMed at ncbi.nlm.nih.gov/pubmed/{PMID}. The references above are a small selection from the wider published research.

What this monograph is not

This monograph summarises what the published research looks at regarding BPC-157 mechanism. It is not a therapeutic recommendation. It is not dosing guidance. It is not a clinical protocol. It is not medical advice.

Cresten Labs supplies BPC-157 as a research compound for lab-based research only. The decision to investigate any compound in any research framework is the researcher’s decision, within their own ethical, legal, and methodological boundaries.

Cresten makes no claim about human therapeutic use, no claim about clinical effectiveness, no claim about safety in human use, and no claim that this compound has been reviewed by any regulator for any medical use.

Researcher questions

Frequently asked questions about Tesamorelin

Common research-protocol and supply questions about Tesamorelin, with answers grounded in published peer-reviewed research and Cresten Labs supply practice. All information is for in vitro and preclinical research only.

What is Tesamorelin?

Tesamorelin is a GHRH analogue, a 44-amino-acid peptide (CAS 218949-48-5, molecular weight 5135.81 g/mol). Cresten Labs supplies Tesamorelin as a freeze-dried vial for in vitro and preclinical research only, with each batch verified at Janoshik Analytical.

What does research suggest Tesamorelin does?

Published research investigates Tesamorelin for GHRH receptor agonism stimulating endogenous growth-hormone release in metabolic and visceral-fat research. The compound is studied primarily in visceral-fat and lipolysis research. Tesamorelin is supplied for research use only and is not approved by any regulator for medical use.

What is the typical Tesamorelin dosage in published research?

Published Tesamorelin dosage in research protocols ranges from 1 to 2 mg per administration, administered subcutaneously, with daily dosing in visceral-fat and metabolic research. Cresten Labs publishes the typical Tesamorelin protocol ranges as research-protocol references only; this is not dosing guidance for human use.

How do I reconstitute Tesamorelin for research?

Standard Tesamorelin reconstitution adds 2 mL plain bacteriostatic water for the 20 mg vial. Use plain BAC water. The FDA label specifies non-saline reconstitution; deviating introduces stability risk.

What is the Tesamorelin half-life and how is Tesamorelin storage handled?

Published research reports Tesamorelin systemic half-life at approximately 30 minutes. Tesamorelin storage: lyophilized vial stable at room temperature for shipping; reconstituted solution stored at 2 to 8 °C and used within 28 days. The Cresten certificate of analysis lists the synthesis date, batch identifier, and the storage conditions verified for this specific batch.

What does the research literature report about Tesamorelin side effects?

Published Tesamorelin research reports the following: mild injection-site reactions reported; the FDA-approved label specifies plain BAC water (not saline). Cresten Labs supplies the compound for research use only; clinical-use side-effect data should be drawn from peer-reviewed clinical trial publications, not from research-vendor pages.

What is the typical Tesamorelin protocol duration in research?

Published Tesamorelin protocol research typically runs daily dosing in visceral-fat and metabolic research. The Tesamorelin protocol duration depends on the research question being studied. The Cresten reconstitution calculator includes a schedule planner that flags the 28-day refrigerated shelf-life of the reconstituted solution.

Where to buy Tesamorelin in Europe?

Cresten Labs supplies Tesamorelin across the EU single market to 16 European countries. Each Tesamorelin batch is tested at Janoshik Analytical with the certificate of analysis published on the website before it lists. Tesamorelin is sold for in vitro and preclinical research only, not for human or veterinary use.

How is Tesamorelin verified at Cresten Labs?

Every Tesamorelin batch is tested at Janoshik Analytical in Czech Republic, an third-party peptide-analysis laboratory. Each batch certificate documents HPLC purity, mass-spectrometry identity confirmation, and contamination panels. The certificate publishes with the batch, before it lists.

Is Tesamorelin legal to import for research in the EU?

Research-use peptides supplied with proper documentation are legally importable into EU member states for in vitro and preclinical research. Cresten ships Tesamorelin from inside the EU single market, so no customs declaration is required for shipments within EU member states. Local research-use regulations apply.