Cresten Labs sells only through crestenlabs.eu and orders@crestenlabs.eu. Any other site or social account using our name is not us.
Skip to main content
Research Use Only, not for human or veterinary consumption Ships across the EU single market Verified, every batch
Order status
CompoundIGF-1 LR3, modified Insulin-like Growth Factor 1 analogue CategoryLongevity EditionCresten Labs Editorial, 2026
Research Use Only declaration

This compound is supplied for in-vitro and preclinical research only. It is not a medicinal product. It is not approved for human or veterinary use in any jurisdiction. No therapeutic, medicinal, cosmetic, or performance-enhancement claims are made or implied. By proceeding to inquire, you confirm you are an adult researcher acquiring this compound within your own research framework. Full terms on the Research Use Only page.

Longevity Research, Modified IGF-1 analogue

IGF-1 LR3

1 mg freeze-dried vial, modified IGF-1 analogue with extended N-terminus

Janoshik verified ISO/IEC 17025 COA pre-published Research use only
70+ PubMed-indexed publications cite IGF-1 LR3 in preclinical and in-vitro literature. View bibliography on PubMed →
Every batch tested for HPLC purity by Janoshik before it ships. You receive the certificate for your batch with your order.
How verification works →
€129.99 In stock, ships within 24h
One acknowledgement step before submission. Inquiry sent to our research desk by email. Confirmation, payment, and dispatch handled directly. EU shipping only.
Certificate format Specimen
Bulk pricing: 5+ 5%, 10+ 10%, 25+ 15%, institutional accounts contact for tendered pricing
Research account standing. Cumulative orders across four rolling quarters trigger pricing tiers (Researcher 5%, Senior Researcher 7.5%, Principal Investigator 10%) applied automatically at checkout.
View standing program →
Custom quote, single or multi-compound Submit a request for quotation Custom quantities, vial-size variants, multi-compound orders, institutional accounts. Quote turnaround typically two to five business days.
Technical specifications · IGF-1 LR3 Cresten Labs reference catalogue

Compound specifications, chemistry, and storage.

Technical specifications

Specimen format
Compound nameIGF-1 LR3 (Long Arg3 Insulin-like Growth Factor 1)
Also known asLong R3 IGF-1, IGF-1 Long Arg3, modified IGF-1
CAS number946870-92-4
PubChem CIDReference CID on COA
InChI KeyReference InChI Key on COA
SMILESReference SMILES on COA
Empirical formula (Hill notation)C400H625N111O115S9
Molecular weight9111.36 g/mol (monoisotopic mass: 9106.39)
Salt formAcetate (default)
Counter-ion contentQuantified per batch on COA. Custom salt forms (chloride, ammonium, TFA) available on quote.
Sequence (1-letter)MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Sequence (3-letter)83-residue modified IGF-1 analogue with N-terminal MFPAMPLSSLFV extension and Arg3 substitution
Length83 amino acids (13-residue N-terminal extension over native 70-residue IGF-1)
Weight basisGross weight per industry standard. Net peptide content quantified on batch COA.
Quantity per vial1 mg
FormatFreeze-dried white powder or thin film, sealed under inert atmosphere. Why does the vial look empty?
AppearanceWhite freeze-dried cake or powder. May also appear as a thin film on the vial wall.
SolubilityWater soluble, reconstituted with bacteriostatic water (1 to 2 ml typical)
Solution colourClear and colourless when correctly reconstituted
Purity (HPLC)Specification ≥98.5%, tested before listing
Identity confirmationLC-MS, batch-specific spectrum on COA
Endotoxin (LAL)Within Ph. Eur. specification, batch report on COA
Storage (freeze-dried)2 to 8 degrees Celsius, sealed, protected from light. Avoid thermal cycling.
Storage (reconstituted)2 to 8 degrees Celsius. Use within 4 to 6 weeks. Avoid repeated freeze-thaw.
Shelf life24 months from synthesis date when storage conditions are maintained
Country of synthesisEU partner facility, Ph. Eur. methodology references
ApplicationIn-vitro and preclinical research only. Not for human or veterinary use.
Research Use Only Supplied for in-vitro and preclinical laboratory research only. Not for human or veterinary use. Cresten Labs does not provide therapeutic or dosing guidance.
Compound monograph · IGF-1 LR3 · longevity research Cresten Labs Editorial, 2026

A modified IGF-1 analogue, and what the published research says about it.

IGF-1 LR3 is a synthetic 83-amino-acid analogue of natural Insulin-like Growth Factor 1 (IGF-1, 70 amino acids), with a 13-residue N-terminal extension and a single arginine substitution at position 3. The modifications were introduced to slow binding by IGF-binding proteins, extending plasma half-life relative to native IGF-1. Published preclinical research investigates IGF-1 receptor signalling, downstream PI3K-Akt and MAPK pathway activation, and cellular proliferation in animal injury and ageing models. The sections below summarise what the published research investigates, what Cresten supplies, and what the certificate of analysis confirms.

Where IGF-1 LR3 comes from.

IGF-1 LR3 is a synthetic 83-amino-acid analogue of native human insulin-like growth factor 1 (IGF-1). Native IGF-1 is a 70-amino-acid single-chain protein produced primarily in the liver in response to growth-hormone signalling, and it is the principal mediator of growth-hormone-driven tissue-growth signalling in mammalian tissues. The natural protein circulates almost entirely bound to IGF-binding proteins, particularly IGFBP-3, which extends plasma half-life but limits free-fraction availability at IGF-1 receptors.

The LR3 modifications were introduced to alter binding-protein interaction. The 13-residue N-terminal extension (sequence MFPAMPLSSLFV) and the substitution of arginine for glutamate at position 3 together reduce binding affinity for IGFBPs, increasing the free-fraction availability of the analogue in plasma. Published research describes the modifications as producing extended biological activity in cell-culture and animal models compared with native IGF-1 administered at equivalent molar doses.

The peptide is produced by recombinant expression in bacteria followed by purification of the disulfide-folded mature protein, freeze-dried, and sealed in vials. PubMed lists roughly 70 papers specifically mentioning IGF-1 LR3 or Long R3 IGF-1 as of 2026, with the broader IGF-1 literature comprising thousands of papers. The research is concentrated in cell-culture studies, animal injury models, and ageing-research contexts.

What the research looks at.

IGF-1 LR3 mechanism research starts from the IGF-1 receptor (IGF-1R), a transmembrane receptor tyrosine kinase expressed on most mammalian cell types. The peptide binds the receptor and triggers receptor autophosphorylation, which initiates signalling through two principal downstream pathways: the PI3K-Akt cascade and the Ras-MAPK cascade. Published cell-culture studies measure receptor phosphorylation, downstream substrate phosphorylation, and the kinetics of signalling activation in defined cell types.

A second strand of research compares the analogue against native IGF-1 in head-to-head studies. The published literature describes IGF-1 LR3 as producing equivalent maximal signalling at the receptor but with extended duration of action, attributed to reduced sequestration by IGF-binding proteins. The functional consequence in cell culture is described as a longer-duration tissue-growth signalling response per unit of administered peptide. In animal studies, the extended duration translates into measurable effects on tissue-growth markers in injury and recovery models.

"The functional difference between IGF-1 LR3 and native IGF-1 in published research is duration of signalling, not maximal signalling intensity, and the difference is attributed to reduced IGF-binding-protein sequestration."

A third line of research examines downstream cellular endpoints. Published cell-culture studies measure protein synthesis rates, cell-cycle progression, and apoptosis pathways as endpoints downstream of receptor activation. Animal injury studies measure tissue-repair markers in muscle and connective tissue. The literature describes the analogue as a research tool for isolating the IGF-1 signalling contribution in research designs that also include growth-hormone-secretagogue compounds at upstream points in the signalling axis.

Where the published research does not go: there are no large randomised human clinical trials of IGF-1 LR3 specifically. The compound is classified as a research peptide, and research is the only context in which it is supplied. The native IGF-1 protein is regulated as a pharmaceutical product separately under different trade names; IGF-1 LR3 is supplied for research use only.

Analytical characterisation

What the certificate confirms.

Every Cresten batch of BPC-157 ships with a certificate from an analytical lab, against the test panel described on the Methodology page. The certificate that ships with your batch confirms:

HPLC purity
main-peak percentage by area at 220 nm, gradient elution, dominant peak. Specification: minimum 98%.
LC-MS identity
Confirmed. Observed mass matches theoretical mass of 1419.55 g/mol within instrument tolerance.
Endotoxin (LAL)
Below detection limit. Specification: less than 5 EU/mg per Ph. Eur. 2.6.14.
Bioburden
Below detection limit per Ph. Eur. 2.6.12 microbial enumeration.
Report on file
Janoshik Analytical (batch certificate of analysis supplied with your order)

The certificate format is shown on the batch verification page.

Cited research

Selected published research on IGF-1 LR3.

Monograph last reviewed 26 May 2026 · references checked against PubMed

The curated reference list for IGF-1 LR3 is being finalised against PubMed and will appear here. In the meantime, the indexed literature is available directly: PubMed results for IGF-1 LR3.

Citation note: each PMID resolves to PubMed at ncbi.nlm.nih.gov/pubmed/{PMID}. The references above are a small selection from the wider published research.

What this monograph is not

This monograph summarises what the published research looks at regarding BPC-157 mechanism. It is not a therapeutic recommendation. It is not dosing guidance. It is not a clinical protocol. It is not medical advice.

Cresten Labs supplies BPC-157 as a research compound for lab-based research only. The decision to investigate any compound in any research framework is the researcher’s decision, within their own ethical, legal, and methodological boundaries.

Cresten makes no claim about human therapeutic use, no claim about clinical effectiveness, no claim about safety in human use, and no claim that this compound has been reviewed by any regulator for any medical use.

Researcher questions

Frequently asked questions about IGF-1 LR3

Common research-protocol and supply questions about IGF-1 LR3, with answers grounded in published peer-reviewed research and Cresten Labs supply practice. All information is for in vitro and preclinical research only.

What is IGF-1 LR3?

IGF-1 LR3 is long-acting analogue of insulin-like growth factor 1, a 83-amino-acid peptide (CAS 946870-92-4, molecular weight 9117.55 g/mol). Cresten Labs supplies IGF-1 LR3 as a freeze-dried vial for in vitro and preclinical research only, with each batch verified at Janoshik Analytical.

What does research suggest IGF-1 LR3 does?

Published research investigates IGF-1 LR3 for IGF-1 receptor activation with extended half-life through reduced binding-protein affinity in research models. The compound is studied primarily in IGF-1 pathway and cell-proliferation research. IGF-1 LR3 is supplied for research use only and is not approved by any regulator for medical use.

What is the typical IGF-1 LR3 dosage in published research?

Published IGF-1 LR3 dosage in research protocols ranges from 20 to 80 mcg per administration, administered subcutaneously, with daily dosing in muscle-pathway and cell-proliferation research. Cresten Labs publishes the typical IGF-1 LR3 protocol ranges as research-protocol references only; this is not dosing guidance for human use.

How do I reconstitute IGF-1 LR3 for research?

Standard IGF-1 LR3 reconstitution adds 1 mL plain bacteriostatic water for the 1 mg vial. Use plain BAC water; acetic-acid stabilized format means NaCl is not preferred here.

What is the IGF-1 LR3 half-life and how is IGF-1 LR3 storage handled?

Published research reports IGF-1 LR3 systemic half-life at approximately 20 hours (vs. ~10 minutes for native IGF-1). IGF-1 LR3 storage: lyophilized vial stable at room temperature for shipping; acetic-acid stabilized format. Reconstituted solution stored at 2 to 8 °C and used within 28 days. The Cresten certificate of analysis lists the synthesis date, batch identifier, and the storage conditions verified for this specific batch.

What does the research literature report about IGF-1 LR3 side effects?

Published IGF-1 LR3 research reports the following: preclinical research reports tolerability across tested dose ranges; the long half-life requires careful protocol design. Cresten Labs supplies the compound for research use only; clinical-use side-effect data should be drawn from peer-reviewed clinical trial publications, not from research-vendor pages.

What is the typical IGF-1 LR3 protocol duration in research?

Published IGF-1 LR3 protocol research typically runs daily dosing in muscle-pathway and cell-proliferation research. The IGF-1 LR3 protocol duration depends on the research question being studied. The Cresten reconstitution calculator includes a schedule planner that flags the 28-day refrigerated shelf-life of the reconstituted solution.

Where to buy IGF-1 LR3 in Europe?

Cresten Labs supplies IGF-1 LR3 across the EU single market to 16 European countries. Each IGF-1 LR3 batch is tested at Janoshik Analytical with the certificate of analysis published on the website before it lists. IGF-1 LR3 is sold for in vitro and preclinical research only, not for human or veterinary use.

How is IGF-1 LR3 verified at Cresten Labs?

Every IGF-1 LR3 batch is tested at Janoshik Analytical in Czech Republic, an third-party peptide-analysis laboratory. Each batch certificate documents HPLC purity, mass-spectrometry identity confirmation, and contamination panels. The certificate publishes with the batch, before it lists.

Is IGF-1 LR3 legal to import for research in the EU?

Research-use peptides supplied with proper documentation are legally importable into EU member states for in vitro and preclinical research. Cresten ships IGF-1 LR3 from inside the EU single market, so no customs declaration is required for shipments within EU member states. Local research-use regulations apply.